PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_21650_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 327aa    MW: 37158.4 Da    PI: 6.5804
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_21650_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.3e-171461148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                          +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
  cra_locus_21650_iso_1_len_1283_ver_3 14 KGLWSPEEDEKLYNYITRFGVGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                                          678*******************************************97 PP

2Myb_DNA-binding47.73.7e-1567110146
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                           rg ++++E++l++++++ lG++ W+ Ia+ ++ gRt++++k++w++
  cra_locus_21650_iso_1_len_1283_ver_3  67 RGMFSQQEEDLIIRLHEILGNR-WAQIAAQLP-GRTDNEIKNFWNS 110
                                           788*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.7E-25664IPR009057Homeodomain-like
PROSITE profilePS5129417.981961IPR017930Myb domain
SuperFamilySSF466894.21E-2912108IPR009057Homeodomain-like
SMARTSM007174.7E-121363IPR001005SANT/Myb domain
PfamPF002498.8E-151461IPR001005SANT/Myb domain
CDDcd001672.01E-101761No hitNo description
PROSITE profilePS5129424.17762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2565117IPR009057Homeodomain-like
SMARTSM007171.7E-1466114IPR001005SANT/Myb domain
PfamPF002493.6E-1467110IPR001005SANT/Myb domain
CDDcd001671.14E-1070112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGRHSCCIKQ KLRKGLWSPE EDEKLYNYIT RFGVGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGMF SQQEEDLIIR LHEILGNRWA QIAAQLPGRT DNEIKNFWNS SLKKKLIKQG  120
IDPNTHQPII ENEAKEEKIC KENASLQISH SSSTSSGVIN TDFGSTGQQL QPVSNNNDNN  180
KQVFDPFFLL EFQANVDPCG YNSSFLNYNG SNLTTLDQKA RTETDFSDTQ MINSNMAEEN  240
AKAAAISSWD SSDNHKFDSV YNQYQLINGI KVEQHHHNHQ VMKPIISPWQ ENSLGDFSEY  300
PLATTTTSLS GEDLNGTNVL DHVFNHL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011047816.11e-115PREDICTED: protein ODORANT1-like
SwissprotQ8LPH62e-82MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A068VIB71e-120A0A068VIB7_COFCA; Uncharacterized protein
STRINGPOPTR_0015s09430.11e-114(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154